PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G207000.1
Common NamePHAVU_008G207000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family EIL
Protein Properties Length: 612aa    MW: 69334.3 Da    PI: 5.5317
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G207000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3514.35.5e-157484251353
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         +el+krmw+d++++krlke+ k     ke  t+a ++++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipekgkpv+gasd+L
  Phvul.008G207000.1  48 DELEKRMWRDKVRHKRLKEQIKA----KEG-TDAVRQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNL 133
                         79*************99999886....787.99********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         r+WWk+kv+fdrngpaai+kyq +n+i ++++++++    ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWPtG+e+ww+
  Phvul.008G207000.1 134 REWWKDKVRFDRNGPAAIAKYQTDNAIEGKNDGCKS-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPTGNEEWWP 223
                         **********************************88.9***************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.XXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.slrkq 270
                         + gl+kdqg+ppykkphdlkkawkv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++ s+  +
  Phvul.008G207000.1 224 QIGLPKDQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKIRKLVRQSKCLQDKMTAKESATWLAIVNQEEALARELYPDycPPfSSGGG 314
                         *********************************************************************************8644566679 PP

                         XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX..............................XXXXXXXXXXXXXXXXXXXXX......XX CS
                EIN3 271 spkvtlsceqkedvegkkeskikhvqavktta..............................gfpvvrkrkkkpsesakvsskevsrtcqs 331
                         + +++l++ +++dv+g +e+   +v+ +k  +                              +++++rkrk + + + ++  k  ++tc++
  Phvul.008G207000.1 315 NGSMVLNDCSEYDVDGAEEEPNFDVEDRKPDHlhpsnlgmeritgrlplqqvshpfkgdvvtNLDFIRKRKIPGDFNLMMDPK--IYTCEH 403
                         ***************88888889999999988***************************************766666666666..6***** PP

                         XXXXX.XXXXXXXXXXXXXXXX CS
                EIN3 332 sqfrgsetelifadknsisqne 353
                          q++++e++l+f+d++++++++
  Phvul.008G207000.1 404 PQCPYNEPRLGFTDRSARDNHQ 425
                         ********************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048737.6E-12948295No hitNo description
Gene3DG3DSA:1.10.3180.101.2E-76168305IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.96E-62174298IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MMMFEDIGFC GDLDLLSCPL GEEDVAVRQI EPDPVVEEDY SDEEIDMDEL EKRMWRDKVR  60
HKRLKEQIKA KEGTDAVRQR QSQEQARRKK MSRAQDGILK YMLKMMEVCK AQGFVYGIIP  120
EKGKPVTGAS DNLREWWKDK VRFDRNGPAA IAKYQTDNAI EGKNDGCKSI GPTPHTLQEL  180
QDTTLGSLLS ALMQHCDPPQ RRFPLEKGVP PPWWPTGNEE WWPQIGLPKD QGPPPYKKPH  240
DLKKAWKVGV LTAVIKHMSP DIAKIRKLVR QSKCLQDKMT AKESATWLAI VNQEEALARE  300
LYPDYCPPFS SGGGNGSMVL NDCSEYDVDG AEEEPNFDVE DRKPDHLHPS NLGMERITGR  360
LPLQQVSHPF KGDVVTNLDF IRKRKIPGDF NLMMDPKIYT CEHPQCPYNE PRLGFTDRSA  420
RDNHQLNCAC RNRAADYGGG SNFHDAEVKP VIFPHSFVQP STTSQAASVV QPSFSVSGLG  480
VPEDGQKMIN DLMTVYDTNV VGNNNLSSNN FVPAENHNFS QTILQQHQQD SRDSFFAGQG  540
MVTEGNFFAR EEGQFERFKT MNMNMNMNAP FDTNHMMFNP QCDLSSFDLK DIQGVGMDPV  600
HKQQEVSIWF Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A5e-851733042133Protein ETHYLENE INSENSITIVE 3
4zds_B5e-851733042133Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141570.10.0hypothetical protein PHAVU_008G207000g
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLV7B6V80.0V7B6V8_PHAVU; Uncharacterized protein
STRINGGLYMA14G04550.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein